SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ERM94553 from Amborella trichopoda 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ERM94553
Domain Number 1 Region: 174-209,283-389
Classification Level Classification E-value
Superfamily SET domain 4.32e-24
Family Viral histone H3 Lysine 27 Methyltransferase 0.031
Further Details:      
 
Domain Number 2 Region: 7-124
Classification Level Classification E-value
Superfamily TPR-like 2.74e-17
Family Tetratricopeptide repeat (TPR) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ERM94553
Sequence length 538
Comment pep:novel supercontig:GCA_000471905.1:AmTr_v1.0_scaffold00010:8781688:8783304:-1 gene:AMTR_s00010p00266780 transcript:ERM94553 description:"hypothetical protein"
Sequence
MELQEMQELRSRANELLLREEWKDCIHVYSKYIALCDGKISNKAQDTSDQEDLKLKKSLC
LALSNRAEARLRSRDFVSALQDCSRALQMDKTHLKTLVCKGKISLEIDHYSEASECFQKA
LTHQTCNNQDEVQKLLERSRRLETQSRTGVYDLSDWVLGKFRGKAPELAEYLGPIQVQRS
YNSGGGRGLFLTKNVDTGTLLFVSKPTAMGRAILPESGDHESARLIMWKDFVEKVHECIS
KSEKIRKMVYSLAAGEEEENLVVPDMELFRPDSENPLHVEQETSIDMDRIMKILDVNSLT
EDGLSVKKLGRLGEDSYGVGLWILASFINHSCNPNARRVHIGDRMLVHASREIRAGEEVR
FSYFDVLLPLTKRREFCKNWGFLCECDRCRIEEGCIDEMLELEREYESGLDPGEVVVKVE
ELILKGRREKGWGKRERWFFRASFWEVYWRVLESERLMRKWGRIIPSPQSLVDDAIMIFG
DERVLRMAKEELKKVGGEKGVRVCRGLYGKIMKKKQAMRALLELSLCDESEKKVKLGD
Download sequence
Identical sequences W1NGD2
XP_006827316.1.86515 ERM94553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]