SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ERM96577 from Amborella trichopoda 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ERM96577
Domain Number 1 Region: 47-258
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.44e-22
Family BAR domain 0.037
Further Details:      
 
Domain Number 2 Region: 291-362
Classification Level Classification E-value
Superfamily SH3-domain 7.35e-16
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ERM96577
Sequence length 371
Comment pep:novel supercontig:GCA_000471905.1:AmTr_v1.0_scaffold00001:9958213:9993680:-1 gene:AMTR_s00001p00270050 transcript:ERM96577 description:"hypothetical protein"
Sequence
MDALRKQATKLREQVAKQQQAVFKQFGGGGYGGSDNVITDEAELQQHQKLEKLYISTRAG
KHFQRDIVRGVEGFIVTGSKQVEIGTKLSEDSRKYGNENSCTSGGTLAKAALSYARGRAQ
IEKERGNLHKALGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQEAEAQAIEVSKRQMKV
REGTGNVDNSAKLDAAEAKLHELKSNMAVLGKEAAAAMAAVEAQQQRLTLQRLIAMVESE
RTFHQRVLQILDQLEGDMASERHRIEASPNPVLDNPPPPSYEEANGLFTSQSPNYDVPSD
SSSYFLGEVMHPYRAESDVELSLSVGDYVVVRKVTRTGWAEGECKGKAGWFPSDYVERRE
RVLANKVAEVF
Download sequence
Identical sequences W1NL64
XP_006829161.1.86515 ERM96577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]