SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ERN09271 from Amborella trichopoda 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ERN09271
Domain Number 1 Region: 152-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000804
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 2 Region: 251-284
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000113
Family CCCH zinc finger 0.0012
Further Details:      
 
Domain Number 3 Region: 97-129
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000301
Family CCCH zinc finger 0.0024
Further Details:      
 
Domain Number 4 Region: 38-63
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000523
Family CCCH zinc finger 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ERN09271
Sequence length 295
Comment pep:novel supercontig:GCA_000471905.1:AmTr_v1.0_scaffold00149:531944:559822:-1 gene:AMTR_s00149p00054910 transcript:ERN09271 description:"hypothetical protein"
Sequence
MDPLVPYRKKAKGDAVASGNGFNHNSSFGELGLAGLGSKSKPCTKFFSMVGCPFGEGCHF
SHYVPGGIHAVSQVQGLASATRRPNSITSTATPTSASLVKTRLCNKYNTPEGCTFGEKCH
FAHGEKELGMSLSSDRTRDPAMAVGGPTRAVPTSFGASATAKISVEASLAGAIIGKGGAH
SKHICRVTGAKLSIKDHETDKNLKNIELEGTFDQINQASAMVREIIMQNSVGNVATRPGL
GPAVAAGSGKVSNYKTKMCENFPKGLCTYGEKCSFAHGAAELRAYMQKYAINGNL
Download sequence
Identical sequences W1PNI4
ERN09271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]