SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ERN10988 from Amborella trichopoda 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ERN10988
Domain Number 1 Region: 46-255
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.49e-27
Family BAR domain 0.018
Further Details:      
 
Domain Number 2 Region: 264-310
Classification Level Classification E-value
Superfamily SH3-domain 0.000083
Family SH3-domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ERN10988
Sequence length 314
Comment pep:novel supercontig:GCA_000471905.1:AmTr_v1.0_scaffold00160:672424:698235:-1 gene:AMTR_s00160p00065370 transcript:ERN10988 description:"hypothetical protein"
Sequence
MDALRKQASKFREQVAKQQQAVIKQFTSSGYESSDVMVTDEAELQRHQQLEKLYSSTRTG
KNFQRDVLRAAEGFMANGLKQIEIGMKLAEDCRKYGVECNDNGMLLKAASLYASARAHVE
KEQEEFNRTLSSQVLEPLRSMVTGAPLEDARHLAQRYSRMRHEAEQQAAEVSRRQAKSRE
APIIENSAKLQVAESKMHEIRANMVVLGKEATAALAAIESQQQRMTLQRLIAMVEAERLY
HRRVAEILDDVEAQMLAEKQRKESAPPVVSPESSSEKALYFLAEAIHAFTAGSEKELSLS
VGDYVVVRQDLSIP
Download sequence
Identical sequences W1PSG7
ERN10988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]