SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ERN15704 from Amborella trichopoda 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ERN15704
Domain Number 1 Region: 44-255
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.18e-22
Family BAR domain 0.06
Further Details:      
 
Domain Number 2 Region: 299-356
Classification Level Classification E-value
Superfamily SH3-domain 7.74e-17
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ERN15704
Sequence length 367
Comment pep:novel supercontig:GCA_000471905.1:AmTr_v1.0_scaffold00048:4878657:4895935:-1 gene:AMTR_s00048p00229110 transcript:ERN15704 description:"hypothetical protein"
Sequence
MDTLKRQASKFREQVSKQQQAVLRQFSTHGGNDTVITDEAEVRCHKKLESLYISTRAAKH
FQKDVVRSIEGLISTSSKQMEIATKLADDCCKYGNESHSSNTTLASASRQFGTSRNSMES
ERENLRRILSTQVSEPLRAMVMGAPLEDARLLTHRYDRIFQEVEAQVAEVGRRQLKAKEP
GANADSAYKLQNAEMKLSELKSSLSALGKEATAAMMSVEAQQQRLTYQRLITMVEAERSY
HKAVADNLDKLHAKMVVEKQRYESGALADVCLSSPSNKDKTENGSGGTANATQKAMYFLA
EVLHPFDAQAEGELSLSVGDYVVVRQVSPAGWSEGECKGKAGWFPSAYIELRDKAPASKI
SDIDPQS
Download sequence
Identical sequences U5CZV7
ERN15704 XP_006854237.1.86515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]