SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pismi1|28570|fgenesh1_pm.19_#_32 from Pisolithus microcarpus 441 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pismi1|28570|fgenesh1_pm.19_#_32
Domain Number 1 Region: 441-482,519-557
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000165
Family UBX domain 0.026
Further Details:      
 
Domain Number 2 Region: 208-296
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000291
Family Glutathione peroxidase-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pismi1|28570|fgenesh1_pm.19_#_32
Sequence length 582
Sequence
MDTLAEDQRDAVRQLQAVLDSQHYDTDVLVSVLQSVGWSVHVCDRSSDKFHSSNSGPQSA
MELLLDGPHPDPSASSESTLSFVDQPRQLPVDRPERPRGTGPLKSLANTVFAVLSLPFHV
VTGILRFILGVFRVPFLSLNFGSNTYRPPRHPQDSRGAIRRWITALEEETGAYNIKSSPS
VATGRDNHPSTSRRHTYPPANPETTRVLPDFFDGTYDEVLDICQKEARIACVILVSEEHD
DVPAFKRVTLTDPDLVRIMSDNNFVVWGGDIRDRIPWDAAQKLQATTYPFVAFLALQPHR
STSTSSFSSGPVLTVLSRHYGPSVPDSGPTSARSLVNHLEGQLLPRVDPFLTRHRAQIQE
RERDRLLREQQDRAYQDSQRRDRERMEAKIRAEREEAERIRKEEETQREEERRLQAERDR
QESIKHRRSQWRRWMRRSIVPPEPRGGDSIRLAIRLPSGRVVRSFPSFSTVTALYAFVDS
QTIPSNMKPQDDPEHPPEGSAGGVETLERFIHSQVQGPESWWGFKLALSYPRREIKWRAN
TSLAEAGLKNGEQLVMEVTSDLGNGKKSLGHDSDDQYESESD
Download sequence
Identical sequences A0A0C9ZVC6
jgi|Pismi1|28570|fgenesh1_pm.19_#_32

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]