SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|344998708|ref|YP_004801562.1| from Streptomyces sp. SirexAA-E

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344998708|ref|YP_004801562.1|
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Cgl1923-like 1.05e-88
Family Cgl1923-like 0.0000656
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|344998708|ref|YP_004801562.1|
Sequence length 353
Comment hypothetical protein SACTE_1097 [Streptomyces sp. SirexAA-E]
Sequence
MIELEGVPELIDPVMVAAFEGWNDAGDAASTAVGHLNREWKGEVFAALDAEDYYDFQVNR
PTVWMEGGSRKITWPTTRLSVVRVGGDKPRDLVLVRGIEPSMRWRSFCNEILGFAHELGV
EMVVILGALLGDTPHTRPVPVSGVTSDPDLARTMDLEETRYEGPTGIVGILQEACTHAGV
PAVSLWAAVPHYVSQPPNPKATLALLNRLEDLLGLRIPLGELPEDARAWQLGVDQLAAED
SEVAEYVQTLEEARDTAELPEASGEAIAREFERYLRRRDVGGPGQAPGGHATESGDMSPY
LRDTAGERTRPPRPQRPEKGRPGGARPDAGSAKEGDAPEDPSTGPDDDTPPTG
Download sequence
Identical sequences G2NAJ4
WP_014045011.1.27930 WP_014045011.1.39937 WP_014045011.1.47793 WP_014045011.1.77718 WP_014045011.1.79727 gi|344998708|ref|YP_004801562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]