SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|511059420|ref|YP_008071305.1| from Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|511059420|ref|YP_008071305.1|
Domain Number 1 Region: 293-490
Classification Level Classification E-value
Superfamily PP2C-like 0.000000106
Family PP2C-like 0.017
Further Details:      
 
Domain Number 2 Region: 529-617
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000015
Family Histidine kinase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|511059420|ref|YP_008071305.1|
Sequence length 626
Comment hypothetical protein H729_02670 [Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1]
Sequence
MDTNLASAALEAFSILLFGIFSLLIVDITLKRKYSIKKSLILSAVLFIIPYILLIFLRLY
AHQFSIDQEIDFFGRQIDLSGISNMLIELSAIMISTFFVYIAVLKCYEGKTSAKVFAASF
AVLISMIASTFFSDYAMLAYNNLTAEGTILVEKSVYVILQTVLLIITLIVYDLFIKNKVK
KLISDTNGEMNRFVVVPIISYVIFIIAYCSWYVEDYTVRESMNLQYFFTSITLPILYALM
FRVIFTEISATAESMKTETELNAAKLIQTSILPQSRFNGTKGISLSAAMIPAKEVGGDFY
DFFELGNGKIAVLIADVSGKGIPAALFMMHAHSIIKNNIILTNSPAEAMTKSNIQLLENN
DSCMFVTVFIGILDLNSGTFTYSNAGHNPPLIKNKSLEYLNVKKQPVLGVVPTTYDDLEV
TLSDDAVIFLYTDGVTEAMDDAGEEYGTERLLNLLKSPGVMNMKDLVDLVNSDVNAYSKQ
PHDDVTMVALEYTGSSTKLSVSAEKKSLEIIQKLISPSLKTDDAKLKSSIMMVIEEIFVN
IISYAYPDSKGTVCVTFDVGDELRMKFEDSGIPFDPLKSKDPDPSLTLYERSEGGYGIYL
VKKFMDTVSYSYENGKNVLTITKKLQ
Download sequence
Identical sequences R9T5D2
WP_020448475.1.21401 gi|511059420|ref|YP_008071305.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]