SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|511059819|ref|YP_008071704.1| from Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|511059819|ref|YP_008071704.1|
Domain Number 1 Region: 45-99
Classification Level Classification E-value
Superfamily L domain-like 0.0000213
Family Ngr ectodomain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|511059819|ref|YP_008071704.1|
Sequence length 149
Comment hypothetical protein H729_04685 [Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1]
Sequence
MVKHPPVLSHNGRWLKRAPPNSQFYHVPEGVEVLDTNCFDASRDTLIRVFLPDTLKKINC
GAFWGLTKLEHVTLPASVIYLDNDVFYDCPALKEIYIMGEPENYGPLCHNCPSVYKVMKK
GRNILREAQSYEIRERGQCSLFDYDKAEA
Download sequence
Identical sequences R9T6U8
gi|511059819|ref|YP_008071704.1| WP_020448874.1.21401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]