SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phyra1_1|86023|fgenesh1_pg.C_scaffold_422000001 from Phytophthora ramorum 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phyra1_1|86023|fgenesh1_pg.C_scaffold_422000001
Domain Number 1 Region: 490-629
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000158
Family Glycosyl hydrolases family 16 0.016
Further Details:      
 
Domain Number 2 Region: 203-270,320-361
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000302
Family Glycosyl hydrolases family 16 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phyra1_1|86023|fgenesh1_pg.C_scaffold_422000001
Sequence length 635
Sequence
MRFYHLVLLMVAVLFASAGPTSAYRGSKLTTPEAQAQVLQDNTPTKRLLRAYTDDEERGI
SIPGLESVLKVFPSSKTKQLQGLLKADETLGNAFKTLGLSKMPIGKDDFIETKMVVKLFS
STNFKVWSKHAARLNKQDPEGAMLTSLTNVFGEKNVATMILLGKHTQSSRQVANKLEAAQ
FKKWATTYKYTADDVFVKAYFFYRSAMVQSWNKFCYRYQGGMIEARVQLPGAVTKASGNP
DLAKGKNSKAKTTKYYPTWPGIWMMGNLGRAIFSGSTNRMWPFSYNKCEPDLFDPSNQRI
SACDDTPGYGLNPNQGRGAPEIDVLEGGGTLVSSSLQIGPGMPDDYRIVPVNFTTGDYYA
CIYAGTCMTPGANYVDVPTAYYKKERSYKSWYQGLRYAANNYCTPDPDEKQRYKTITASL
KTGITNNSCSSDVCPASNDVNGDLSLIDGKGEGHWGINSNGTCYPLFNVYTGSYLCDPDN
TYSKCAAPRNETTTPKSNAMSSFNYQMDAISANWPVHLGAYTNFVVYQLEWVTGKNGYVR
WMLEGNPLFEVASESISKVPQNSNKTNPEKIMLEEPMYIIFNVALSSSWGATPPNAGKEC
RGNGTDPVVNKICDSFPLYLKIDYTRLYQDLAGDL
Download sequence
Identical sequences H3H5U1
164328.JGI86023 jgi|Phyra1_1|86023|fgenesh1_pg.C_scaffold_422000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]