SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phyra1_1|74677|fgenesh1_pg.C_scaffold_9000080 from Phytophthora ramorum 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phyra1_1|74677|fgenesh1_pg.C_scaffold_9000080
Domain Number 1 Region: 114-162
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000222
Family Ovomucoid domain III-like 0.0084
Further Details:      
 
Domain Number 2 Region: 174-218
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000208
Family Ovomucoid domain III-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phyra1_1|74677|fgenesh1_pg.C_scaffold_9000080
Sequence length 733
Sequence
MKIAVGLVLAAIAVASVRAGDPATLSTKEEATKTTKSTKTGAASSSGIGSLFDDGSSGVI
GDESGAVDPKLLTSIGITVPMDGSKLNLGPGPAVYPSDSGSFDWSWDSIEGSGSAHYDCD
TVCTTDYEPVCGSDNTTYTNDCAFTVAQCNATELVLASTGECALSSTSTSGEASVAGSAA
ASCPDACTTDYSPVTDENGKEYSNECFMRIAKCKGEESGEKKKTITFSDFLNDDSQKSDP
TLVKGTKETEAPILATKSEKSTKSEKSTKTGSTSSSSIGSLFEDGSSGTIGEGSGSADPT
LVKGTKETEAPILATKSEKSTKSEKSTKTGSTSSSSIGSLFEDGSSGTIGEGSGSADPTL
VKGTKETEAPILATKSEKSTKSEKSTKTGSTSSSSIGSLFEDGSSGTIGEGSGSADPTLV
KGTKETEAPILATKSEKSTKSEKSTKTGSTSSSSIGSLFEDGSSGTIGEGSGSADPTLVK
GTKETEAPILATKSEKSTKSEKSTKTGSTSSSSIGSLFEDGSSGTIGEGSGSADPTLVKG
TKETEAPILATKSEKSTKSEKSTKTGSTSSSSIGSLFEDGSSGTIGEGSGSADPTLVKGT
KETEAPILATKSEKSTKSEKSTKTGSTSSSSIGSLFEDGSSGTIGEGSGSADPTLVKGTK
ETEAPILATKSEKSTKSEKSTKTGSTSSSSIGSLFEDGSSGTIGEGSGSADPTLVKGTPA
PAEKTLPASKTTG
Download sequence
Identical sequences H3GFZ2
164328.JGI74677 jgi|Phyra1_1|74677|fgenesh1_pg.C_scaffold_9000080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]