SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phyra1_1|75685|fgenesh1_pg.C_scaffold_14000047 from Phytophthora ramorum 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phyra1_1|75685|fgenesh1_pg.C_scaffold_14000047
Domain Number 1 Region: 212-493
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.11e-75
Family Mitochondrial carrier 0.00065
Further Details:      
 
Domain Number 2 Region: 30-159
Classification Level Classification E-value
Superfamily EF-hand 1.33e-21
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phyra1_1|75685|fgenesh1_pg.C_scaffold_14000047
Sequence length 501
Sequence
MADASAPKPQQVKAEQRAKLVRRNSRVTVDQLLREAFARVDIDMDGKVDALDIQRGLRVA
GVKLSADDVGRLMARLDPKNQGQLSYEDFHALHDAFIVQTFRSFDKENKGYLVDEDLQNG
LQALGVTVTLQEATSMIQQLHPRDAHCVHEADFKYLYLLLRSKMASPTALEHFLWDPDVR
QLSKNWWKASVEVGEGGLRVPLPADKDGQVKKVSPVIKFFGGALSGVIEALILTPLDVTK
TRMQLDKTGQYRGMVDCGKKLVAAEGPKGLFKGFTPWTVHVVLKNGTRFYFNAIFRRMLA
DQNGQVSGANEFLAGALAGATEAVLIVTPFEVIKTRLQGQDIIKGKIPKYQGPVHTAVTV
IKHEGPLALWKGLAPTIGRQGLNQACSFWSNNFIKKHVWKLQDGDSLPAWKSGLTGMIGA
IPGPCINCPMDVVKTRLMAQETAAGAGGKYKGMVDAMVVVAKEEGVGALYKGLVPRLARL
CPSYGIQWLVMDKVTEYFSKN
Download sequence
Identical sequences H3GI43
jgi|Phyra1_1|75685|fgenesh1_pg.C_scaffold_14000047 164328.JGI75685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]