SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phyra1_1|76315|fgenesh1_pg.C_scaffold_17000077 from Phytophthora ramorum 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phyra1_1|76315|fgenesh1_pg.C_scaffold_17000077
Domain Number 1 Region: 62-259,457-573
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000598
Family Glycosyl hydrolases family 16 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phyra1_1|76315|fgenesh1_pg.C_scaffold_17000077
Sequence length 757
Sequence
MWYQQSAVWAFAVIWVATTASVLAKNSTTASTTYPTKSGIRTWVDPDTPKNRQKYTSSRG
REWDLVMSDEFNVANRSFRPGDDHIWTSLEKPDGVNGALELYSHNMTSTKCDDDGTCYFY
IKAMDELNVIHVYNMYTHPPGYVDAYFFYRAAMVQSWNKFCFQGGMLEVRAQLPGAVSAA
SGNPDLALGNNAKVQTTKYYPTWPGIWMMGNLGRAIFSASTNRMWPFSYDKCEPDVFNPD
NQRISACDDDPGYGLNPNQGRGAPEIDVLEGGGLAVSSSLQIAPGMPDNYRLFPVDTSIG
DNLYCVYGYTCTTPGANYIDVPTAYYKEERGHRSWYQGLRYASNNFCQQNPEAKQTYATV
AASLKAGITENSCSVETCPASGDVNADIGLIDDVGENHWGINTNGTCYPLVNSYMGSYLC
DPDNTNSKCASPRNESTTPKSNAMSSFNYQMDAISSNWPVHLGAYTDYVDYQIEWVTGSK
GYVRWMLQGNPLFEVTTDAFSNVPQNASKKNPQKVMLEEPMSLILNVALSSSWGATPPNA
GKECRGDGADDVTNKICDSFPMYLKMDYMRLYQDLGDDLDADNYMQVGCDPASHPTKKWI
EGHIDEYEDDDNQWKEVSGKAFCSVDDDCTIGGNLGKTALKTGKCVKSRCQCTYSSSWGG
PRCTTAISSSSSSGSTSKSSYGPPMGLSIGLAGIIVFLSFISVYWSIFAVVKTKSVTEMK
KSAIYDQDDGPMRQSKASYPNDLGQRQPRDNYSQNFV
Download sequence
Identical sequences H3GJH2
jgi|Phyra1_1|76315|fgenesh1_pg.C_scaffold_17000077 164328.JGI76315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]