SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phyra1_1|76325|fgenesh1_pg.C_scaffold_17000087 from Phytophthora ramorum 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phyra1_1|76325|fgenesh1_pg.C_scaffold_17000087
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000848
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 2 Region: 247-353
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000203
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 3 Region: 642-736
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000000523
Family Ypt/Rab-GAP domain of gyp1p 0.017
Further Details:      
 
Domain Number 4 Region: 467-619
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000811
Family Ypt/Rab-GAP domain of gyp1p 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phyra1_1|76325|fgenesh1_pg.C_scaffold_17000087
Sequence length 849
Sequence
MEGVLWSREGRGKLLRGWHKRYLVLSESGVLCEYSADASARARSSGMTLRREVDVRRCAV
KTLPFPLVGRHNAFQVKSQQLSDNSTEEKQTLKFVLSARQAEEMRQWVAALRSAALTVAI
PRRPSPMTWESDSGANEAESEFIEVKMPQRADMAHLSSVYEWIHECCVKTAQNLTVAGVH
VPRGSLLVSANGVSLQTLTSVEVRKLLLESTGTLPVSLRFLRSPAKCGVLRAKLYTSPLT
QLKSLARYRKSSRMNWKEQVVDLSGDLLTCQLKVKTPMAIGNSRKSSSHSKTKRVLLLSS
GSSVKPVHELVSDRKFCFMVTVQAHSMLFQARSEADRRAWTDAIQRAITIAEGLVPGGAL
ARGSFDLDALQLQSSMNMRHLDQAFKGMEEGDDAVGFDDDIECASGGDEDDDELSPADAA
LLLPSAEDWTSATQSAAYLPDRELTEMLRVLQSSGRFIEALQLMQKNTTLRPKYWRQIFR
WALNPAPDAAENCENFKQLTCTSLSEEDDLQVQKDIPRTVKWLAGSAGAPKLDDNERAVR
LERLEHVLHAFLSSCSLDVRTDEDPVSPTSAGSSPSSSSFYMQGMNGLAFILLEVLENDE
VEAFRFLRGIVARILPHVFGICCEGTGRDHFDLFRSLVEVGDVLQEVARLHLPNFHAALE
RAGLPVCLLAYKWFPTLFSDVSLTASHSQLRYDTLLCCWDVCLLLGLEGMFCVALALCSA
AEDDVLALAGCGDAAQHSAEQVSATVGRTLALLSPEDLITSVCEVLELCSHPVLLKLRNA
HRRRLKLGYSKVGNGFALSGTRTSPDRTVSKKPDEVVLPPPMTVTDLDSGKVFKISNSGN
MLLPTSAPR
Download sequence
Identical sequences H3GJI1
164328.JGI76325 jgi|Phyra1_1|76325|fgenesh1_pg.C_scaffold_17000087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]