SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phyra1_1|77523|fgenesh1_pg.C_scaffold_25000044 from Phytophthora ramorum 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phyra1_1|77523|fgenesh1_pg.C_scaffold_25000044
Domain Number 1 Region: 259-471
Classification Level Classification E-value
Superfamily HCP-like 3.4e-19
Family HCP-like 0.008
Further Details:      
 
Domain Number 2 Region: 684-885
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000066
Family Clostridium neurotoxins, the second last domain 0.033
Further Details:      
 
Domain Number 3 Region: 442-579
Classification Level Classification E-value
Superfamily HCP-like 0.000000000458
Family HCP-like 0.016
Further Details:      
 
Domain Number 4 Region: 55-171
Classification Level Classification E-value
Superfamily HCP-like 0.00000000863
Family HCP-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phyra1_1|77523|fgenesh1_pg.C_scaffold_25000044
Sequence length 952
Sequence
MVKFIAFLLLLACWVAAEAARESDIRRALGELATSAEQQDGITIQDLLEGPPELTTSLPL
FKQLVREDRRELLLQIGELHLFEDGSVPHNATHAELFLQASAGHGSSQAQFLLGALRAAS
DDSAGAQLYYAFATRGQSIGASMALGYRALHGYGSRKSCTAAMRHYKLAADRVVTQQNDQ
KLQLYAFPEPARLSETEGARYHGDLNPAEDFNRAEYLRQRAADLRNTDVMVQSASITLFS
DLYGVTAMSDLEEHAAREREALRFLERSIEMGSIKAQALLGHVYAYGLAGCKSNASRAVE
LYEAALNASEGNPSGEAANGLGVIFSRGIGDMPVDPDRARNLFKVAANAGHAEGVYNTGM
SFLELGSHLSSRAKEYLVAAAHVGHLKSLFQLARLKQRQIHTIGGATTSSTSCQEVVELY
KRVAEYSREGTTLMTQALTHAQRGNWALALELYLIAAEMGYEVAQNNAVWLIERVQRQVF
GTPSIRDSKLLERLYARLVNRAFEQDSIDALLRMGDSAYQDEDYTVALRHYQHADLVSAG
TSARALFSVGYMHEHGLGVSFISPERATLYYHLAGEKEPSLRIVMVLLQFKLRVQTMFSQ
VAETVRCVWLTITQRSDEATASTEDISSSRMAQGVEEGPALTSSDVSALDTHGSAFQQQT
NTLADSAALVRAATRSDPHEYAVALQFLGDQSRVYLELARGDLPLEQQDFTIETWLRVDE
FSARNDEQQVITLVDALDNFQLELLPATETADDCWMLRFRKFSLVDKQLPELVLSFPNAP
LSPHTWNHVAVTFDATYQTATLVLNAKVKQVLSFRPHPASPSRKEESSNDGSSSSQFLAV
GSSLGRIYGMSPPNSRAFSGQIVHFRLWKSRKNVKEVSVLMLEQYDEVGTRGLLVHLRYK
LHGASASSSTHSANSGRSNSNQATNRVMNGDRTIPNAEGVQLKIVEFPPPNN
Download sequence
Identical sequences H3GM43
164328.JGI77523 jgi|Phyra1_1|77523|fgenesh1_pg.C_scaffold_25000044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]