SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phyra1_1|80200|fgenesh1_pg.C_scaffold_47000022 from Phytophthora ramorum 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phyra1_1|80200|fgenesh1_pg.C_scaffold_47000022
Domain Number 1 Region: 178-243
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.81e-20
Family DNA-binding domain from rap30 0.0033
Further Details:      
 
Domain Number 2 Region: 10-109
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.000000000392
Family Rap30/74 interaction domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phyra1_1|80200|fgenesh1_pg.C_scaffold_47000022
Sequence length 249
Sequence
MAEPEEVVEPLHLELEDREVYLAKIPTALGASWKNVQESELMLGSIKLEKKSALGRRKGM
LTVNPSTLVDDIPTEYRVEVSETPLKLKVFSLDGSGRMAIEGTVKNSCTVMAQRNDQYSK
MCKQRLIKSMVKTRIVQPLEDLPRVKKARIQFTIEKPDAEGEEDDADSKLLDRSDKKIKM
SKDELKNLVFHHFEERDYWPLKELNYHCRQPESFLKEVLKEICVYHRKGPNKSCYELKPQ
YKDGVSTNA
Download sequence
Identical sequences H3GT06
164328.JGI80200 jgi|Phyra1_1|80200|fgenesh1_pg.C_scaffold_47000022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]