SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phyra1_1|81635|fgenesh1_pg.C_scaffold_62000017 from Phytophthora ramorum 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phyra1_1|81635|fgenesh1_pg.C_scaffold_62000017
Domain Number 1 Region: 296-432
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.5e-21
Family Nuclease 0.033
Further Details:      
 
Domain Number 2 Region: 139-237
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000000345
Family Phospholipase D 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phyra1_1|81635|fgenesh1_pg.C_scaffold_62000017
Sequence length 524
Sequence
MIQPLLKATDWFITEEDIVDSRGGVPRDGLQTYTTGNNVTVYTAANEFFSAVVDDFSATK
EGDRVMYTGWDTCVIPFEADVDPTGAKTGFDVMFKGIVERGGSVNLLSWPNFLLTSQNTN
ARDAINEIPPSKVNGAKAVYLFDDRLPLAASSHHQKTIVIAANKSTGKDDHPISYVGGID
LTNDRWDTIYHNNTAIREAANIPFRNKGWMDAHFRIHGPASKEVANNFLQRWNSDYKPCQ
GLEDDLLSFDNPDYEKLPPIDYASSNTSSKLGNQNIQIVRTFSCTYKHYKEFAPRGEQSL
FKARLKALRNAKNFIYIEDQYFIYVPELLDALMEVLPRIQRLIVLVQPPDALLKASGYEK
YLYEMIGPMKEKFPNKVQIYTTKKDLDIYVHTKLVLIDDVYVSLGSANWNRRSMTSDSEL
NANIIDDETVESPDGVTVLKLARDMRVRKFVEMTRLSYEELAAMKFIDAADQFKVAAQDE
STILTNFSVKDHTYYITFVDVFREQVDPQEVCNFSGSGSTRKVE
Download sequence
Identical sequences H3GW31
164328.JGI81635 jgi|Phyra1_1|81635|fgenesh1_pg.C_scaffold_62000017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]