SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|507516612|ref|YP_008038229.1| from Burkholderia sp. RPE64

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507516612|ref|YP_008038229.1|
Domain Number 1 Region: 358-642
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.62e-19
Family Integrin alpha N-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 234-337
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000000294
Family Cysteine rich domain 0.066
Further Details:      
 
Weak hits

Sequence:  gi|507516612|ref|YP_008038229.1|
Domain Number - Region: 102-158
Classification Level Classification E-value
Superfamily LmbE-like 0.0144
Family LmbE-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507516612|ref|YP_008038229.1|
Sequence length 733
Comment putative uncharacterized protein [Burkholderia sp. RPE64]
Sequence
MTVVHLIGGANDAKFDYVILRETGTKLAYARMAGVPDQWDESTVTFAGKPLHQLVLTQQP
RVKLLELRLPGGHVRGGKVPLGLLWDRGQTLTTYPMNADGTGATDYDRASLSATLREILA
PATEIYTLNPDTVAFMEHPDHIYAARITRVVAQSLKRDVPIGYHVTYPTGGLPKNLTADE
TLKKRDVVGSYFAIDGNEAGHVFGEYMWDGNWVARRYWSMAHANDPGPDFQLRSFQLVNE
YSSRCVESAGAGKPPRLAACSDAASQNWFWQQLPTMPGDKNDALLVNAATRGCVAERDAG
LVEQTCSASNAAQRWTPWDFGFVYTPLNHCLGEKDGALNAGRCAMLTAQYRWSPSPHSVW
TDTRHEGALYGDVKGTGRDSVVYVQRRKDGPGFNVWVAEMSRIDGASPWYLNAVPFDPHA
TEATCRGDAFCFDSARFLLADFDGDGRADLMVIAPRNGGTAFWLLKSAGTHFEAPRLWFQ
TSADWTPANAQQYVAGDFNGDGRADVLIARKRADAGLDLDVLTAGPSTGNAPTRWLEARE
LDAGARFMPARVAGSGGSRNAGLIAIEDVNGALALSQFASTGSAFSPAYRTNTYAQFKAA
FVKVVAGDIDGDGIDDIAVLQPRGTATGTRVFTMKGGKIFGPARDTATLADTSYADSMPA
LIRRNEHDNHATLVLFRRANALLKEFYYTGGAPSVAGYDFDSAFGLGPVQIWGDLPGLFS
ESLWLKTLAYWSR
Download sequence
Identical sequences R4WHU6
gi|507516612|ref|YP_008038229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]