SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427715517|ref|YP_007063511.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427715517|ref|YP_007063511.1|
Domain Number 1 Region: 11-93
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.4e-17
Family Ferredoxin domains from multidomain proteins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427715517|ref|YP_007063511.1|
Sequence length 97
Comment ferredoxin III [Calothrix sp. PCC 7507]
Sequence
MAQLTGLTFGGKTWTPKFAQAIDKDKCIGCGRCIKACGYNVLGLMALNEEGEIVEDEDDE
EIERKVMKVANPENCIGCEACSRICPKNCYTHVALES
Download sequence
Identical sequences K9PDP6
WP_015126505.1.42896 gi|427715517|ref|YP_007063511.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]