SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427715528|ref|YP_007063522.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427715528|ref|YP_007063522.1|
Domain Number 1 Region: 5-66
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.33e-16
Family 7-Fe ferredoxin 0.037
Further Details:      
 
Weak hits

Sequence:  gi|427715528|ref|YP_007063522.1|
Domain Number - Region: 55-109
Classification Level Classification E-value
Superfamily SCP-like 0.033
Family Micothiol-dependent maleylpyruvate isomerase C-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427715528|ref|YP_007063522.1|
Sequence length 113
Comment 4Fe-4S ferredoxin [Calothrix sp. PCC 7507]
Sequence
MIELVSHKLCINCNLCVQVCPTNVFDAVPNQPPAIARQEDCQTCFMCEAYCPADALYVAP
ESHTHVAVNEDDLIERDIMGEYRRILGWGYGRKNNSELDTAHKLRQLPRPYQS
Download sequence
Identical sequences K9PC19
WP_015126516.1.42896 gi|427715528|ref|YP_007063522.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]