SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427715571|ref|YP_007063565.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427715571|ref|YP_007063565.1|
Domain Number 1 Region: 35-95
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000000011
Family 7-Fe ferredoxin 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427715571|ref|YP_007063565.1|
Sequence length 139
Comment 4Fe-4S ferredoxin [Calothrix sp. PCC 7507]
Sequence
MIELVGCRTLSDNAPYKYCTQIKCGETYKTMIELVSASRCIKCNICVSACPTNVFDKVLN
APPTIARKSDCQTCYICELYCPVDALFVAPQADESVIVDEQTLIESGLLGTYRQRLGWGR
GRTPAAQVEESAKFFKYAP
Download sequence
Identical sequences K9PCP5
gi|427715571|ref|YP_007063565.1| WP_015126559.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]