SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427716129|ref|YP_007064123.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427716129|ref|YP_007064123.1|
Domain Number 1 Region: 59-98
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000445
Family ComEA-like 0.034
Further Details:      
 
Domain Number 2 Region: 165-200
Classification Level Classification E-value
Superfamily JAB1/MPN domain 0.0000693
Family JAB1/MPN domain 0.0074
Further Details:      
 
Weak hits

Sequence:  gi|427716129|ref|YP_007064123.1|
Domain Number - Region: 98-214
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.0235
Family Histidine biosynthesis enzymes 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427716129|ref|YP_007064123.1|
Sequence length 242
Comment DNA replication and repair protein RadC [Calothrix sp. PCC 7507]
Sequence
MTYCLRIADLPTNERPRERLMTHGSSILATAELIAILLGTGQGPGKLSAVGLGQYILSEL
GKHQRDPLAVLREVTPAELMQIPGIGPAKATTILAAIELGKRAFQSRPDGIPIDSPAAAA
ATLSHDLMWQVQEKFAVVLLDVKNRLLGTQVITIGTATETLASPREIFREVIRQGATRVI
VAHNHPSGNVEPSQEDIELTRQLLAGAGFLSIPLIDHLILGNGNYQSLREVTTLWDEHPQ
GD
Download sequence
Identical sequences K9PEU4
gi|427716129|ref|YP_007064123.1| WP_015127112.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]