SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427716149|ref|YP_007064143.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427716149|ref|YP_007064143.1|
Domain Number 1 Region: 3-159
Classification Level Classification E-value
Superfamily IpsF-like 4.97e-66
Family IpsF-like 0.00000491
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427716149|ref|YP_007064143.1|
Sequence length 161
Comment 2-C-methyl-D-erythritol 2,4-cyclo diphosphate synthase [Calothrix sp. PCC 7507]
Sequence
MTKIRIGNGYDIHQLVSDRPLILGGVKIPHELGLLGHSDADVLTHAIMDAMLGALSLGDI
GHYFPPSDPQWAGADSLVLLTQVNQLVSDRGWQIGNIDSVVVAERPKLKPHIDKMRDQLA
TVLKLQPNQIGIKATTNEKLGPVGREEGICAYAVVLLIAAD
Download sequence
Identical sequences K9PEW7
WP_015127132.1.42896 gi|427716149|ref|YP_007064143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]