SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427716185|ref|YP_007064179.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427716185|ref|YP_007064179.1|
Domain Number 1 Region: 2-169
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.73e-43
Family N-acetylmuramoyl-L-alanine amidase-like 0.0006
Further Details:      
 
Domain Number 2 Region: 176-254
Classification Level Classification E-value
Superfamily PGBD-like 0.000000000675
Family Peptidoglycan binding domain, PGBD 0.039
Further Details:      
 
Domain Number 3 Region: 261-311
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000091
Family Peptidoglycan binding domain, PGBD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427716185|ref|YP_007064179.1|
Sequence length 313
Comment cell wall hydrolase/autolysin [Calothrix sp. PCC 7507]
Sequence
MKFGIDSGHNCPPDTGAKGFKFEDNLTLDVGNRVIAKLQALGHEVVVCRPTSASTVRDSL
SKRCDKANASKVDIYVSIHFNCFNGQANGTEVFAISNTSNKIAKPVLDEIVKLGFFNRGV
KSGSHLFVLRNTNMPAILVEGCFLDSKKDMDLYNPEAMANAIVKGLTGKLPTTPVTPVPD
EEQNADTTILRLQKALNRLKVTDKNGKSLLEDNLAGAATNSATAKFQTIVGLPPTGSADK
ATWDAINLILAKRIIRQNHAGGPVVRYLEYRFGSQIDGVYDSVLELKVKSFQKQNGLVDD
GIIGNLSWQKLIG
Download sequence
Identical sequences K9PD79
gi|427716185|ref|YP_007064179.1| WP_015127168.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]