SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427716192|ref|YP_007064186.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427716192|ref|YP_007064186.1|
Domain Number 1 Region: 16-372
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 1.44e-41
Family Nitrous oxide reductase, N-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 375-471
Classification Level Classification E-value
Superfamily Cadherin-like 1.52e-25
Family Dystroglycan, N-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  gi|427716192|ref|YP_007064186.1|
Domain Number - Region: 692-789
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00719
Family Integrin alpha N-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427716192|ref|YP_007064186.1|
Sequence length 816
Comment Ig family protein [Calothrix sp. PCC 7507]
Sequence
MTKKILNFVEVQKNNTNRVDGLGGSFFAAISLDGKFLYASGYDDSAVVVFERNQQTGELT
FVEVQKDDINGVDGLGSAEALALSPDGKFLYVPGYSDSAVAVFERNQQTGHLSFVEVQKD
DTNGVDGLANATSVTVSPDGKFLYATGYGDSAVAVFERDEQTGQLSFVEVQKDDTNGVDG
LAGALFVTVSPDGKFLYAAGADESAVSVFERDEQTGQLSFVEVQKDDTNGVDGLAAVNSV
AVSPDGKFLYAAGFGDSALAVFERDEQTGKLTFVEVQKDNINGVDGLNAATSVTVSPNGK
YLYATGYYDSAVAVFERNQETGELTFVEVQKDDTDGVDGLAAATSVTLSPDGKHLYASGS
YDSAVVVFSTPFNHAPEVANEIQDQEATEDSVFNFTVPVDTFSDADAQDILTYTATLVND
DLLPTWLNFNPTTLTFTGTPTNNDLGSLDIKVTAKDIAGDQASDVFTLAVDEKTAVNIQS
TSLLTKITGDIFSIKTKLNIKGDKAKLSIKIKTNASKQVDELCVFNVDDDEGKIDGIAPG
AEGYAKVALLRSKVIFCSLGNSPNGFNTTDSTNILEFESNTKLRFYMISNSTTQAVLSGK
ASFSSVVFSSATNSNTENEGFSLNFQDLVVTVEATNQQVTLGTGLQGKKEGELIDLRGVG
QSVKADFKVHREAAFNNFVGFYKVADESGGIDTNGDGKADILVGQAGYAEAAIRGRVAGI
DLTVTNQGTASYTGTFGADSLFAPFIIVDGKPDAFFDSNANNDPKLYFAFLGANTDKTDH
IRLLGNNSFGFEDLANGGDKDYNDVIVQISLTANAV
Download sequence
Identical sequences K9PFR8
gi|427716192|ref|YP_007064186.1| WP_015127175.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]