SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427716613|ref|YP_007064607.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427716613|ref|YP_007064607.1|
Domain Number 1 Region: 87-398
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.73e-36
Family Pectin methylesterase 0.045
Further Details:      
 
Weak hits

Sequence:  gi|427716613|ref|YP_007064607.1|
Domain Number - Region: 629-660
Classification Level Classification E-value
Superfamily Sporulation related repeat 0.0116
Family Sporulation related repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427716613|ref|YP_007064607.1|
Sequence length 664
Comment parallel beta-helix repeat-containing protein [Calothrix sp. PCC 7507]
Sequence
MIPPVVFPNYRKAGFLPAKLITKGDKPKSFPELALPSVSRSSVLFFTVGVGAASMTSLGA
NLGSAVAQMPPTTDQKTSGERTISQVNVLFVNPSVGDDTQGNGGERTPLKTITQALRLST
ANTVIMLSTGTYSAENGEVFPLILRAGVSIQGDARNKGQGILIQGGGEYLSRSFGGQNVT
IVGAKQAGLTGVTVTNTNPRGYGLWIESSNPTITENTFTGSTQDGISVTGNAAPTIRQNY
FYRNGANGITIAGDSQAQIRENIFQQTGFGINIAQNAAPVIVGNQIQNNRSGIVVQANAR
PILRSNLIQGSKEDGVVAIAQAMPDLGTPGEPGGNQFQNNARYDINASAAKQVINASGNT
LSQNRIAGKVEIQAQTSLIARNPLPLPTPSPNRILQEIPNNGEIVFSAPGLGETPNRLST
PLPSNSNVRNNIPTGKLNTQLLPLNAANVSPFVPKPNPQPPTSRVAGFPTPSSLARKGKP
IRTPIPQTAIATPKPTQSPNLPGLNYVQIDPNSIEFTAPNSPLPRTRNQQQPLPRQEATA
QQFAIRNNLPSTASALPVPSSNIPMGNTRNMQKVAVPESYTTGSYGGSSPYAKASQSVRY
RVLVEVASDRDQELVRYLAPGAFSTVSRGRSVMQVGVFSNQYNADGMMRTLNTNGLRAII
ELLN
Download sequence
Identical sequences K9PF48
gi|427716613|ref|YP_007064607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]