SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427716893|ref|YP_007064887.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427716893|ref|YP_007064887.1|
Domain Number 1 Region: 147-211
Classification Level Classification E-value
Superfamily DNA-glycosylase 0.0000209
Family Endonuclease III 0.03
Further Details:      
 
Weak hits

Sequence:  gi|427716893|ref|YP_007064887.1|
Domain Number - Region: 194-275
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 0.0046
Family 5' to 3' exonuclease, C-terminal subdomain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427716893|ref|YP_007064887.1|
Sequence length 323
Comment transposase IS116/IS110/IS902 family protein [Calothrix sp. PCC 7507]
Sequence
MSKIVLGIDISKKDFHVTLILENQTTKSKVFKNNPEGFVNLQNWLIKQGATQVHGCMEAT
STYGEALAEFLVENGHKVSVVNPSRIKGFAKSELLRTKTDKVDAAVIARFCLAIAPELWT
PLPVEVKELQALLRRLESLTDMYQQEQNRLETATPTVAALIESHLEQLKQLIVQVKQLIH
DHFERHPDLKAKRDLLTSIPGIGEQTAAVLLTEIGCLEQYRNARQLAAHAGLTPQERSSG
SSVQGKSRLSGVGNARLRKALYMPAVAAMRHNPLLKLFAQRLLDRGKVKMQVLAAVMRKL
LHLAFGVLKSQKPFDPDYLAHAS
Download sequence
Identical sequences K9PP16
WP_015127871.1.42896 gi|427716893|ref|YP_007064887.1| gi|427719374|ref|YP_007067368.1| gi|427720887|ref|YP_007068881.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]