SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427717120|ref|YP_007065114.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717120|ref|YP_007065114.1|
Domain Number 1 Region: 1-287
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 3.67e-74
Family Aldo-keto reductases (NADP) 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427717120|ref|YP_007065114.1|
Sequence length 288
Comment NADP-dependent oxidoreductase domain-containing protein [Calothrix sp. PCC 7507]
Sequence
METKQLGNTGIFVSAIGLGGMPMSIANRPAESQSIAVIHRALDLGITFIDTADSYCLDES
DKHHNEKLIHKALTSYNGDISQVVVATKGGLMRPNGSWGRNGSPEHLRQTIRESYEALGS
EKPIDVWQYHAPDPNYTIAQSLAPVKEAVDAGLIRFVGVSNFSVEQIKQARDVVDIVSVQ
NQYSPWERQPEIDGVLKYCQQEGLTFLPWSPFGGSRRHANLADIPAIAQLAKSKGVSVYN
IVLAWLRSQSPAILPIPGASKISSIEDSARAADVTLSHEEVQQINRAT
Download sequence
Identical sequences K9PFS7
gi|427717120|ref|YP_007065114.1| WP_015128096.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]