SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427717556|ref|YP_007065550.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717556|ref|YP_007065550.1|
Domain Number 1 Region: 39-212
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.71e-74
Family HD domain 0.00000183
Further Details:      
 
Domain Number 2 Region: 201-417
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.9e-63
Family RelA/SpoT domain 0.0000136
Further Details:      
 
Domain Number 3 Region: 400-472
Classification Level Classification E-value
Superfamily TGS-like 3.92e-22
Family G domain-linked domain 0.096
Further Details:      
 
Domain Number 4 Region: 674-751
Classification Level Classification E-value
Superfamily ACT-like 0.000000000234
Family AF1403 N-terminal domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427717556|ref|YP_007065550.1|
Sequence length 756
Comment (p)ppGpp synthetase I SpoT/RelA [Calothrix sp. PCC 7507]
Sequence
MSSTVINSSIDVPLPEWLQKCLSESSRGGSQAEDDRRHSDAVLIGEAFKFAYRLHQGQYR
KSGEPYICHPVAVAGLLRDLGGSAAMIAAGFLHDVVEDTDVTIEQIGELFGPEVRQLVEG
VTKLSKINFKSKTESQAENFRRMFLSMAQDIRVIVVKLADRLHNMRTLQVMPDDKRRRIA
QETRDIFAPLANRLGIWHFKWELEDLSFKYLEPESFREIQQHVAEKRTSREEKLARATTI
LQERLKQAGIECLDVSGRPKHLYSIYQKMQRQQKEFHEIYDLAALRIIVRTNEECYRALA
VVHDAFRPIPGRFKDYIGLPKPNRYQSLHTGVIGLTGRPLEVQIRTQEMHHIAEYGIAAH
WKYKETGGSNVSNLTTSDEKFTWLRQLLEWQSDLKDAQEYLDSVKDNLFEDDVYVFTPKG
DVVPLSPGATTIDFAYRIHTEVGNHCAGARVNGRMVPLSTRLQNGDIVVIMTQKNSHPSL
DWLNFVRTSAAKYRIKQWYKRSRREENVARGRELLEKELGKTGFDSLLKSDAMHSVSEKC
NYHSTEDLLAGLGYGEITLNLVLNRWREVVKAHQPIVNAPLVPTKESAAATKALRDGPAT
SRTTDSPILGVEGLVYHLAGCCTPIPGEPIIGVVTRGRGISIHRQGCNNLDSVEYERLVP
VRWNSGAETSSIPQTYPVNLQIEALDRVGVLKDILSRLSDQGINVRHAQVKTAIGQPALI
DLGIDIRDRPQLEHVFVQIKKMSDILNIRRVGQIDE
Download sequence
Identical sequences K9PIE7
gi|427717556|ref|YP_007065550.1| WP_015128530.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]