SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427717851|ref|YP_007065845.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717851|ref|YP_007065845.1|
Domain Number 1 Region: 71-597
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.41e-137
Family Arylsulfatase 0.000000963
Further Details:      
 
Weak hits

Sequence:  gi|427717851|ref|YP_007065845.1|
Domain Number - Region: 637-782
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000601
Family Laminin G-like module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427717851|ref|YP_007065845.1|
Sequence length 786
Comment sulfatase [Calothrix sp. PCC 7507]
Sequence
MAKLTDIKLNSQAIAFLTALTLMFSSLLPLPAWADYGEKLPLPQQSFKGKIGLTYKESQP
DFPKPIKAPDKAPNVLLVLLDDVGFGQTSTFGGLINTPNLDRLAEKGLRYNQFHTTALCS
PTRAALLTGRNHHSVSTGVITELATGYPGYTAILPRSAATVAEVLRDYGYNTAAFGKWHN
TPDYETSAVGPFDRWPTSLGFEYFYGFLGGDTNQWSPALVENTQHIQKPNRPDYHLTPDL
ADHAIKWIRTQQAIAPDKPFFTYFATGATHAPHHAPKEWIDKYKGKFDQGWDKLREDIFA
RQLALGVIPADTKLTPRPAELPAWDSLTPTEQKVYARQAEVFAGFLSHTDAEIGRVIDAI
AQLGELDNTLVLFIAGDNGASAEGGLTGSVNEFKVFNGVAENPQEVLAALDDLGSPKTFN
HFHAAWAWAVDSPFQWTKQIASHFGGTRNGLVVAWGEHIKERGGVRSQFHHVIDIAPTIL
EAAGIEPPKVVNGTKQQPIEGTSLVYSFDDPAAPTHHKTQYFEMLGNRAIYDQGWVAAAR
HGRLPWERVSKTTFDQDSWELYNVASDFSESTDLANQNPAKLAQLQNLFLKEAKKYKVLP
LDDRLLQRFDVKTRSNLSTERNSFTYYTSVAGIPEGSAPNIKSRSFSITADVDVAKDGTK
GVLVTQGGRFAGWSFFLQDGKPTFAYNFLNSDRTIIQSSQPIAIGKSKIKFDFTYDGGAP
GAGGTGKLLINDQQVAEGRIEQTVGYRFGLDETFDVGQDTGTPAVDTYQTPFAFTGNLQQ
VTLELK
Download sequence
Identical sequences K9PJ88
gi|427717851|ref|YP_007065845.1| WP_015128824.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]