SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427717869|ref|YP_007065863.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717869|ref|YP_007065863.1|
Domain Number 1 Region: 179-298
Classification Level Classification E-value
Superfamily Cupredoxins 5.2e-44
Family Periplasmic domain of cytochrome c oxidase subunit II 0.001
Further Details:      
 
Domain Number 2 Region: 14-116
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit II-like, transmembrane region 3.92e-22
Family Cytochrome c oxidase subunit II-like, transmembrane region 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427717869|ref|YP_007065863.1|
Sequence length 336
Comment cytochrome c oxidase subunit II [Calothrix sp. PCC 7507]
Sequence
MKIPSSIWTLLIGIVLTLASLWYGQNHGLLPTAASDEAILVDGLFNTMMIVSTGIFLLVE
GILIYAAFRYRRRAGDNEDGPPVEGNVPLEILWTAIPAIIVLGISVYSFDVYNEMGGFDP
HAIHEAPMTMDMSSMHMSGTALAATLSDTPPTLASDNDHAQMQPEHLTTIAQNAEESSKP
ADLVVNVAGLQYAWIFTYPDSGITTGELHLPIGRQVQISMTANDVIHAFWVPEFRLKQDA
IPGRTSEFRFTPRKPGDYVLICAELCGPYHGAMRTQVVVESEEAYNNWVQEQLVASRENL
NQAVALNPADLSPHEFLAPYTKDMGIQPEMLHQMHK
Download sequence
Identical sequences K9PJR6
WP_015128842.1.42896 gi|427717869|ref|YP_007065863.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]