SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427718229|ref|YP_007066223.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427718229|ref|YP_007066223.1|
Domain Number - Region: 21-168
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0115
Family HD domain 0.08
Further Details:      
 
Domain Number - Region: 402-439
Classification Level Classification E-value
Superfamily Geminin coiled-coil domain 0.085
Family Geminin coiled-coil domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427718229|ref|YP_007066223.1|
Sequence length 897
Comment CRISPR-associated protein Csc3 [Calothrix sp. PCC 7507]
Sequence
MSKRNRLLNNLPKTLEEIYFSEIRPQLYENHAHHHQYGVRKGTTLAEHLDSACQFILTVS
RIAEVPEDKRPLLLAATAVHDLNKLDTKGRNVKTLARNQEFLREQLEKACVLSFVISEDD
LELVRKLIERHSGHNVSDGARFLPEDPNIERWAAMLTAADLFDLGIPDAQRFRKLEKELT
VAFGRSCNLFRISISEDKGYITALLLGACEEVLQKYGLNPLAIFPDGELFEGEALSNVDF
TKEIAAVWQSKIDQVFGNNIEKLVRATNNGIKINHQAIEQNIEEVLVNVLALLEKKKAGY
KSDKVAKDVTKWGDNAGENALNKAAELGLLAVSNGEEFAISEGLKAAYISYRKAELSPKE
IWDKIAVHTGISEQQRTALEAFEGLYGRPLFAAKAAVKGIEGIKEALQESFQLRKESTQI
SEETEVSEEMIAAVSRMVNLPFAIRLNGGDDLNAYVEANPRQRCSLGSTSTDIDELISDN
MPPGTKVQAFSNRLPGGISAEPKRQADSIAALAYQLMAVGANFPAVKKQDPLYLHLALPK
GSAPELLRIWRGLLKQLAATNAEGGTVTIDELKLYKDNQLEFKANKVVGLALPKRPDFVH
TSVIIPLLWGDVNNSLALLKSLRLALEISLSLDIGFPFVLSSNLEVELSNDVYGRIEGIP
SALQTLLGNGQYQQRQDAEKILERLRCIGKLATSVASIQKADDCLYDLARACVRPIELYY
VLLRWTLREQDEPNLSVIWSRICEPLNTLLESFMPDENLLLTKYLREAAQVAAEGKIWGS
SFKRTAQAEPFTAFIAAIRSQKAYLGLDVIFAALVQQYHTRLDRIREHGVGATKYEQVKR
YYELLRKLYEEVYSARPEKFLSDQKTLEAAYLFFLEEARKQLKSESKDDSVETTTTV
Download sequence
Identical sequences K9PKV0
WP_015129199.1.42896 gi|427718229|ref|YP_007066223.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]