SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427718252|ref|YP_007066246.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718252|ref|YP_007066246.1|
Domain Number 1 Region: 236-334
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 2.35e-19
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0025
Further Details:      
 
Domain Number 2 Region: 161-227
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000000134
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0021
Further Details:      
 
Domain Number 3 Region: 79-160
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000000183
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427718252|ref|YP_007066246.1|
Sequence length 339
Comment mechanosensitive ion channel protein MscS [Calothrix sp. PCC 7507]
Sequence
MMQWILPIAFIFAGLLAGIIGEKFIFQRLKIFVAKKQIPGSEVIFQSLHRMTFIWFAITG
FFWAILTSPLKSDVTGILQKILTIIFLYSVTLVLSRLSAGFVSLFLRRTSGVSASLLSNL
AKSAVLVLGTLILLQTVGVQITPLITTLGISGLAVGLALKDTLENLFSGFYLIISKQVRT
GDYVKLEANHEGYVTDISWRHTTIKELSNNVIIVPNSKLASAIFTNYHLPVKEITLTINV
GVDYESDLEQVERVTVQVAKEVMQEIAPELMENEPYIRFNKFGDFSIDFTLYMRVNEFFD
QRIGKHLFIKKLHKCYQKEGIKIPFPSRELYMQENQAKI
Download sequence
Identical sequences K9PLL2
WP_015129222.1.42896 gi|427718252|ref|YP_007066246.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]