SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427718283|ref|YP_007066277.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718283|ref|YP_007066277.1|
Domain Number 1 Region: 9-190
Classification Level Classification E-value
Superfamily ClpP/crotonase 8.71e-73
Family Clp protease, ClpP subunit 0.00000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427718283|ref|YP_007066277.1|
Sequence length 201
Comment ATP-dependent Clp protease proteolytic subunit ClpP [Calothrix sp. PCC 7507]
Sequence
MIPIVIEQSGRGERAFDIYSRLLRERIIFLGQQVDNSIANLIVAQLLFLDADDSEKDIYL
YINSPGGSVTAGMGIFDTMKHIRPDVCTICTGLAASMGAFLLSAGAKGKRMSLPHSRIMI
HQPLGGAQGQATDIEIQAREILYHKKRLNDYLAEHTGQPIERIAEDTERDFFMSPEEARE
YGLIDQVIDRHAAGSRPVAVV
Download sequence
Identical sequences K9PJY1
WP_015129253.1.42896 gi|427718283|ref|YP_007066277.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]