SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427718845|ref|YP_007066839.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718845|ref|YP_007066839.1|
Domain Number 1 Region: 90-137
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000068
Family NfeD domain-like 0.0071
Further Details:      
 
Weak hits

Sequence:  gi|427718845|ref|YP_007066839.1|
Domain Number - Region: 22-95
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0772
Family ABC transporter transmembrane region 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427718845|ref|YP_007066839.1|
Sequence length 144
Comment hypothetical protein Cal7507_3613 [Calothrix sp. PCC 7507]
Sequence
MPSYTLIWLLAGSALCLTELFLPSAFVTFLMGMSAFVVALLSRVGLVSLWLQVVVWLLLS
TLLVAGSRRFVQRRRRSSKIQDATIAETLTEILPGRTGRVLYEGNSWQARCDDENLSVAP
DQRVYVVRREGTTLIVMPENLLNS
Download sequence
Identical sequences K9PKS1
gi|427718845|ref|YP_007066839.1| WP_015129812.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]