SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427718870|ref|YP_007066864.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718870|ref|YP_007066864.1|
Domain Number 1 Region: 111-228
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.41e-36
Family NlpC/P60 0.00000131
Further Details:      
 
Domain Number 2 Region: 13-84
Classification Level Classification E-value
Superfamily Prokaryotic SH3-related domain 2.01e-24
Family Spr N-terminal domain-like 0.0000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427718870|ref|YP_007066864.1|
Sequence length 245
Comment NLP/P60 protein [Calothrix sp. PCC 7507]
Sequence
MVTNQSTIQNHQSVEYNCLADLNLYNSPECQSLATQASAGRHLRITSNYQDAAVEVYLCE
DDYPGWVSLTNLDLLQPATLPYQARLWAESEIKKLLPEVISFTHKAMQQANYYLWGGTVG
PNYDCSGLMQTAFVSVGIWLPRDAYQQEGFTQPIAMTELAPGDLVFFGTPQKATHVGLYL
GDNHYIHSSGKTQGRNGIGIDVLSEMGDEVSRSYYQQLRGAGRVVKSYEPRGEAGGRAQG
AGGKS
Download sequence
Identical sequences K9PKU7
gi|427718870|ref|YP_007066864.1| WP_015129837.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]