SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427718885|ref|YP_007066879.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718885|ref|YP_007066879.1|
Domain Number 1 Region: 8-123
Classification Level Classification E-value
Superfamily CheY-like 5.12e-36
Family CheY-related 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427718885|ref|YP_007066879.1|
Sequence length 125
Comment response regulator receiver protein [Calothrix sp. PCC 7507]
Sequence
MNTTLLGTILIVEDSPSELELMSHYLQESGYHVIQATGAKEALEKALLEQPDAIVTDVVM
PGVSGFELCRYLKRNPVTEKVPIVICSSKNLEIDRLWGMRQGADAYLTKPYTREQLLRAI
KSVVI
Download sequence
Identical sequences K9PKW0
WP_015129852.1.42896 gi|427718885|ref|YP_007066879.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]