SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427719349|ref|YP_007067343.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427719349|ref|YP_007067343.1|
Domain Number 1 Region: 42-151,200-367
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.04e-41
Family Filamentous hemagglutinin FhaB, secretion domain 0.016
Further Details:      
 
Domain Number 2 Region: 433-609
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000251
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 
Domain Number 3 Region: 568-674
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000659
Family Filamentous hemagglutinin FhaB, secretion domain 0.051
Further Details:      
 
Domain Number 4 Region: 673-802
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000377
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427719349|ref|YP_007067343.1|
Sequence length 1071
Comment filamentous hemagglutinin family outer membrane protein [Calothrix sp. PCC 7507]
Sequence
MAQIWQYLVSISTLFSSIFFINLDTKALAQSITIDGTLGTPQTLTGPDYVIPQAAGQAVG
NNLFHSFGKFNLNSNEAAIFQSNPNIQNILSRVTGGSQSLIDGLIRTQTGVNLFLINPNG
IIFGQNARLDVGGSFVASTANALQFGNLGFFSATEKNVPSPLLTINPSALFFNQINQNAA
IQNNSVAPAGTDPAGFRAFGLRVPDGKSLLLVGGNVSMDGGQLNANGGRVELGGLAAPGN
VNLLFNGDNLSLQFPENITRADVSLTNQAFVSVARAGGGDITVNARNLEMFTGSLLFTGI
RRGLGTTTTVAGDITLNATNNIKVVGSGVVNQILPQATGNAGNINITATTLSLSERATLS
ASTFGSGKAGNITIRASDFVDINKSNLSSQADQGSIGSAGDVTIETGRLFVGNNAQISTG
TIRTSTGAGGNLTINALNSVDLANNSGIFTDTEGIGAAGDLKITTRHLNVQDGGVIFGGT
SSTGRGGNMTINALSVDIIGVSALGNYSGILSESTGFGDAGTIIINGDRLSIQGGGVLAA
RTSQQGKGGTITINASDTVELSGTAPNGSVTSLSSQTRGTGAGGALTINTRQLKVENGAQ
ISVSTFGQGKGGNLQVAASDLIELRGRSQSGFSSGLFAQVNARGTGDAGNLTVTTRQLTL
NNGAKISVATLGAGQGGNLNIMTPGGAIALIGTAADGTSSSITAGTDGTGKAGNVTITTA
KLVVQAGAAVQASTQGFGEGGTLTINASDSINLEGVSADGRFFSGLTTQTLGAKAAGNLT
LNTAQLNIQNGAGVSVGSLGTGKAGDLEINARFIQLDNRGSIFSGTYSGDGGNISLRLQD
LLLLRRNSFISATAGTAQQGGNGGNITINTPFIVAVPNENNDITANAFTGTGGKVTINAT
GIYGITPRSREDLVKLLGTNEPKDLNPAKLPTSDITAISQTSPTLNGDVILNTPDLDPSR
GLTELPANLVDVSQQIAQGCTPKGKIASRFISTGRGGLPLNPDEPLRGRAVITNWVTLGE
GNQEREITQRPTPETIVEAQGWIINADGNVELVASVPSSSYGVLSSSCDMR
Download sequence
Identical sequences K9PNZ6
WP_015130312.1.42896 gi|427719349|ref|YP_007067343.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]