SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427719945|ref|YP_007067939.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427719945|ref|YP_007067939.1|
Domain Number 1 Region: 698-798,825-888
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000000000999
Family HD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427719945|ref|YP_007067939.1|
Sequence length 923
Comment 7TM receptor with intracellular metal dependent phosphohydrolase [Calothrix sp. PCC 7507]
Sequence
MKTQRFFQSLNQQLNNWRRRYKVLLRKRPLLEAVSSKNGKSRRRKLHRIVLSNIIVFLSK
INDLSRAQKLGIGKRVRAKLAKSQGLLNIVGFSWVHKKRFSVVLAIAVISLTGVIGHKLY
NQPKLKVGTVAPQTIKAPYTDSIENQRKTEDQRRAVSQKSMPMLMIDTSVNEQVGRNLRQ
LLDEGDEIRAAAGSFPFFDTSVLSLSSQRYLRSCPESEWQELLVTLETTKKQKLELFLPT
QRGSFHRRLTREQDTTSSAKAGKQISAPPPSSTQKRQTQTTPLGAAPQNRSVLPSKSGET
KSTNPPTLEFTQAVAELETYRITTTDRNLSSLIDQILQARQKYAQANTKLLQMEAVKPQA
VYENTILLNLSDEDWVKTQVGIHDSSKRILAQGIPYGLPRDVLEAAVSLQVQTFVTTEAE
PLAIKMLSVVLQPNLKQDEAETRKQAQRAANGVPAFMVQVKRGDVIVAKGENITAWNFDV
LEHYHLNRREVNWLELGKVAGVVSTAVAIFVFVERQIQIQLRQRDRLLVLLLTLSVPGIL
TTSLPYTTWSAIGILLGSFYGPVLGVTVVSLLSLVLPTTLEIGRIALVAGAAGGIVGSCM
AKRLRSREELALLGVAIATTQGGIYLMLSVFVGAAFGSRWYVVLREAAFFALSGLAWSIV
ALGLSPYLEKLFDLVTPIRLAELANPNRPLLKRLATETPGTFQHTLFVATLAEAAAKQLK
CNVELVRAGTLYHDIGKMHDPLGFIENQMGGPNKHDTEINDPWKSAAIIKKHVTEGLVMA
RKHVLPTAIQAFIPEHQGTMLIAYFHHQAQQMAQANPNLTVDDADFRYDGPIPQSRETAI
VMLADSCEAALRSLKDVNPEQALVMVNNILRARWQDNQMIDSGLTRDEMTKIAKIFVEVW
QQFHHKRIAYPKLKTSNEKIAKH
Download sequence
Identical sequences K9PNU6
WP_015130902.1.42896 gi|427719945|ref|YP_007067939.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]