SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427719956|ref|YP_007067950.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427719956|ref|YP_007067950.1|
Domain Number 1 Region: 31-381
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.98e-37
Family Filamentous hemagglutinin FhaB, secretion domain 0.02
Further Details:      
 
Domain Number 2 Region: 445-527,559-588
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000264
Family P22 tailspike protein 0.074
Further Details:      
 
Domain Number 3 Region: 600-682
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000879
Family Filamentous hemagglutinin FhaB, secretion domain 0.05
Further Details:      
 
Weak hits

Sequence:  gi|427719956|ref|YP_007067950.1|
Domain Number - Region: 383-464
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000722
Family iota-carrageenase 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427719956|ref|YP_007067950.1|
Sequence length 840
Comment filamentous hemagglutinin family outer membrane protein [Calothrix sp. PCC 7507]
Sequence
MRAMSNDKLPSIFIFTTRLLTLGIMSSAILLWSPCAKAQVTSDGTTNTIVNSNGNNFTIL
NGIEKGKNLFHSFSNFSVPNGSSATFDLTNTPNITTIFSRVTGGNVSNIDGLISTLNGSN
PVSLFLMNPAGIVFGENAALNIGGSFVGTTANSIKFADGTEFSTNNPSATPLLTMSVPIG
LQMGQAPGKITVRNTGHRLGPSRFSAPNRSKNPLGLGISSNNTLALIGGEIGLDGGVLTA
PSGHIELGSVRTGTVNLNTILRAWSFDYNNVQQFEDIRFSHQALADSSGAPAGSIHIQGQ
NISFNEGSVALLVHQGNQNSGDIVVNASESLDLRGVGSYGFFNSFLQTNTIGNGAGGDLV
VSASRLLLEDGARIITQAFGAGVGGNVSVEVADSIQFRGYSSVDPGLNSSIASITSGSGS
GGDIQVKTGRLRVQDGATLLTASIGVGTAGNSTINASELIEVIGESPFVPSSLLATTLNR
GNAGQLTINTPNLSVQDGGSVSTTTLGVGNAGSLYINVPNEITVSGKGAISGTSSRIGAR
AEILSPAFQKLFNLPALPTGKSGNLIVNTSRLQITDGAIIGVDHQGVGKAGDLRLHGDTI
FLDRAGSITAATKSGEGGSINLQANTLVMRHGSNVTATAGGTGNGGNIFINSPIILGLEN
SDIVANAVKGQGGNINITTQGIFGLEYRPQLTAENDITASSQFGINGTVEVNTIGIDPNS
GLVELPVNVTDPSQQIASGCSANQGSRFVATGRGGIPQNPTQEVRSDVYDGLRLRTWSDI
RDLSAYRQTGELRVQILPNPEVLVQATSWHRNAQGKVELIAAPSPTYVQQALTCASVKRN
Download sequence
Identical sequences K9PQ77
WP_015130913.1.42896 gi|427719956|ref|YP_007067950.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]