SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427720058|ref|YP_007068052.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427720058|ref|YP_007068052.1|
Domain Number - Region: 22-76
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.00235
Family TTHA1013-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427720058|ref|YP_007068052.1|
Sequence length 124
Comment hypothetical protein Cal7507_4865 [Calothrix sp. PCC 7507]
Sequence
MNSFSSLTPQIKNQDNREVLVNVIVKQGSDGRTIAIVPGIPELQVEASDRATALSQIQQR
LETHLAGAEIVSLPVKLPSLEPKNPWLEMAGVFKDDPQFEQMLAAIESYRNELDKTIEDD
ASQE
Download sequence
Identical sequences K9PQ19
WP_015131014.1.42896 gi|427720058|ref|YP_007068052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]