SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427720419|ref|YP_007068413.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427720419|ref|YP_007068413.1|
Domain Number 1 Region: 601-729
Classification Level Classification E-value
Superfamily OmpA-like 1.83e-32
Family OmpA-like 0.00036
Further Details:      
 
Domain Number 2 Region: 176-226,258-450
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.11e-24
Family Pectate transeliminase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427720419|ref|YP_007068413.1|
Sequence length 756
Comment OmpA/MotB domain-containing protein [Calothrix sp. PCC 7507]
Sequence
MFNLQVCWLGDVQFGEKAKQLKSYQNPIFYFLPFTLCLLGSEVAFSQTPMQLHSVAEINK
QKISQLPSILPSSPLRVVVNSNQDAVQPDDQLTLREAIQLVNGTLSVAQLSSAEKALVQP
LTDISSRIEFNLPANATTIFLQKELPALASPGLVIDGSTQPGYKESESATAEIAIPVPVV
TITAAPNQEVIRGLTVVSDRTTIRGLNLYGFNAEPIKQQLGNLLVYDGVPKPTTLTTPPG
DIVIAHSMPPNNNQKDVPPKNVVIENNWLGLTIDEKMPAQTSAFGVYVFNAQGAKIRRNR
IYYHDGSAIITSVKGENTLVQENIIVGNGIAGMPDALRVEGIVGNSQITGNLICANDGAG
VYLFKPEGDVQIRDNRIIYNGRRLRRAAVYLTGSNHQVTGNQITHQTGPGVVVSAFQQSQ
RNTIQNNTFAALEGLSIDLNTQGNLDVSDWQRGDGPNPPRNSPNRRLETGNGAINAPEFT
AREFVPSGNGVTLQGKADPGSEVTIYRLGDYQKGKQALYESGYGALSQPLATAPVDAKGN
FSFTVENLQVGDVVSAIATDPKYGTSEPAFGSIIGAKGTLPNLSPSPNTNPIIVPQCTSR
PVPPPTLVPPVQIEIPPTPLRLQVPRNVHFALDKSFISPASAIVLDRVAQVLRQYPFIVI
EIQGHTDPRASDDYNLALGRRRALATRNYLLRQGVAPERMTIRSLGESQRVSDGSDRIDY
ARDRRAEIIFKDIRGIEIIIEGQEQDLQIEPSRGRR
Download sequence
Identical sequences K9PRZ2
gi|427720419|ref|YP_007068413.1| WP_015131370.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]