SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427721053|ref|YP_007069047.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427721053|ref|YP_007069047.1|
Domain Number 1 Region: 3-255
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.73e-45
Family CAC2371-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427721053|ref|YP_007069047.1|
Sequence length 259
Comment type 12 methyltransferase [Calothrix sp. PCC 7507]
Sequence
MSVFGNYARYYDLLYRDKDYVGEAQFIHQLIQTHAPNAQNILELGCGTGNHAVLLAKEGY
KIHGVDFSQEMLDKAESRLSQLPPDLTSRLNFSQGDIRQVRLNQTFDVVISLFHVISYQT
TNEDLLAAFATVKEHLKPGGIFIFDVWYGPAVLTERPTVRVKRLEDEEILVTRIAEPVMH
PNENLVDVNYQVFIKNKASGVVEDLQETHQMRYLFKPEIEFLCDTFQLLPIESYEWMTKQ
KASLETWSVCFVFHKTFDQ
Download sequence
Identical sequences K9PSX8
WP_015132002.1.42896 gi|427721053|ref|YP_007069047.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]