SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427721300|ref|YP_007069294.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427721300|ref|YP_007069294.1|
Domain Number 1 Region: 1-366
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.64e-61
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00011
Further Details:      
 
Domain Number 2 Region: 337-450
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.53e-37
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427721300|ref|YP_007069294.1|
Sequence length 450
Comment NADPH-glutathione reductase [Calothrix sp. PCC 7507]
Sequence
MTYDYDLLVIGAGSGGIATARRAAEYGAKVGVVEFDRLGGTCVNRGCVPKKLMVYASRFP
DQFAEAVGYGWSPVESSLDWEKMITAVNNEVTRLNGIYQQMLDKSKVEILQGYGKFVDTH
TIAVGERQVTADKILIAVGGHPIRPNILGIEHAITSDDIFNLKEQPKRIVILGGGYIGSE
FACVLNGLGTEVTQVIRGDKILRGFDDDLRSEIQEAMGKHGIRILNNIQLIAIEKDAAGV
KVTVRGEEGTEETVVADAVSLAAVGRKPSTHNLGLENTGVKLHDGAVVVDQYSRTADENI
YAVGDCTNKINLTPVAINEGRALADTVFGGKSRTMSYDNVPTAIFTTPEAATVGLTEAEA
REKYGDAVKIYRSRFRSMYYTLPGKEEKTLMKLVVNEKTDKVLGAHMVGKDAAEIIQGVA
IAIKMGATKANFDATVGIHPSSAEEFVTMR
Download sequence
Identical sequences K9PSS9
gi|427721300|ref|YP_007069294.1| WP_015132248.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]