SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427715572|ref|YP_007063566.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427715572|ref|YP_007063566.1|
Domain Number 1 Region: 25-256,343-401
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.51e-55
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.032
Further Details:      
 
Domain Number 2 Region: 426-536
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 3.79e-19
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427715572|ref|YP_007063566.1|
Sequence length 548
Comment FAD dependent oxidoreductase [Calothrix sp. PCC 7507]
Sequence
MLLAIKQLGESVTVSPHDSEPASTPGSHLDLEADVLVIGGGPAGAWAAWSAATQGAKVIL
VDKGYCGTSGATAAAGTTVWYVSNPANREAELSKRETLGGFLSDRYWMNRVLDQARINLN
RLVEWGYPFSPDENGHPYLPSLHQGAEYMRLMRKQVKKIGVKILDHSPALELLVDADGAV
AGANGINRQTGESWTVKAGAVILATGGCAFLSKSLGCNVLTGEGYLMAAEAGAELSGMEF
SNVYGLTPAFASVTKGAYYRYATFTYEDGTVLENSDRRTIARALRTQPVYACINKASETE
KSWMQTIQHNFFLPFERVGIDPFTQRFPVTLRLEGTVRGTGGLRIVDENCATSVAGLYAV
GDAATRELICGGASGGGSPNAAWASASGVWAGEAAVTYGQKLGEKVNKRSLHRIGNAAVD
RDSNRTFDPTAVIKAVQAEVLPCDRNLFRTEQNLSASLNKLHHLWNEVRHTSATSNQQIQ
AREAAAMVATARWMYATALERKESRGMHKHEDYPQLDVKQQHRLISGGLDSVWVKPEQNI
SIRELVKK
Download sequence
Identical sequences K9PDV2
WP_015126560.1.42896 gi|427715572|ref|YP_007063566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]