SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427716872|ref|YP_007064866.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427716872|ref|YP_007064866.1|
Domain Number 1 Region: 530-696
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.3e-45
Family Histidine kinase 0.00046
Further Details:      
 
Domain Number 2 Region: 317-451
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.19e-24
Family Heme-binding PAS domain 0.023
Further Details:      
 
Domain Number 3 Region: 461-542
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 7.26e-23
Family Homodimeric domain of signal transducing histidine kinase 0.0011
Further Details:      
 
Domain Number 4 Region: 173-315
Classification Level Classification E-value
Superfamily GAF domain-like 1.33e-19
Family GAF domain 0.0054
Further Details:      
 
Domain Number 5 Region: 69-146
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000159
Family Heme-binding PAS domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427716872|ref|YP_007064866.1|
Sequence length 710
Comment multi-sensor signal transduction histidine kinase [Calothrix sp. PCC 7507]
Sequence
MTDERINILLLFDNQTKVRATTTAATNVEDYAGLMPLLLGLGVNSAAFQPQFQLIHAQEF
WEIRDEFPELIGKNPLQLTKLESQELMIKNLLSGSEKTCEVIVVIKDGSTIPVELQGKVI
SYAGQQMQVVAVRDITERKQTQEALQIRENTRRKQSQTLVQIARSKTFQEGNLNAAFKEI
TEAAARTLLVQRVGVWLYNEDHSAIECIDLYDLRTGEHTCGVSLLKASYPAYFQALEAER
SIAAHDALNDTRTQELSESYLSVLGIASLLGAPIWLGGRLVGVVSHEHLDEVRQWTLEEE
NFAGSIADFITVAIEASDRNAAQEALRHSEAQFRAIFERSPIGIGLTDMKARIVDTNPAL
SQMLGYSREELCNQRLTDYISQEKGDLELYRQLASGIDVDIKQLVERHRLEMERLFVRKD
GGVVWTQLSVSIIPDSNGKPEFFLTMIEDITERKQTELKLRASQAAAEAGSRAKSEFLAT
MSHELRTPLNAIMGLSQLLQQEMVGSLNEKQQEYISCVYSSGEHLLALINDILDLSKVEA
GKEELLLLPLPVTELCNSVISTLCDQASEKGLQLITEIDPKADICIADERRAKQMLLNLL
TNAIKFTPGGQVSLEVKKIPEGITFTVADTGIGIDANQFQFLFEPFKQLDSRLNRQYEGT
GLGLALTRKLARLHGGDVTVESTLGAGSRFTLFLPEQPYLDAESNFPSKI
Download sequence
Identical sequences K9PHM8
gi|427716872|ref|YP_007064866.1| WP_015127850.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]