SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427718128|ref|YP_007066122.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718128|ref|YP_007066122.1|
Domain Number 1 Region: 227-392
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.51e-42
Family Histidine kinase 0.00086
Further Details:      
 
Domain Number 2 Region: 7-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.31e-32
Family KaiB-like 0.00074
Further Details:      
 
Domain Number 3 Region: 148-233
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000235
Family Homodimeric domain of signal transducing histidine kinase 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427718128|ref|YP_007066122.1|
Sequence length 395
Comment histidine kinase [Calothrix sp. PCC 7507]
Sequence
MPVSQDQPIYSEAPLQLLLFVDGRPKSRQQVQRIRAYLKELQAEYNFELQIIDVGQQPYL
AEHFKLVATPALVKIHPEPRQVLAGSNIIAQLKNWWPRWQTAVDAYLKLQEDLQERIDEN
GRMSSAKSTIRSVAVSAELIRLSDEIFRLKQEKEKLQEQLQFKDRVIAMLAHDLRNPLTA
AAIAIETLQSNYNLETGGFGRLKPAMTAHLLKQARSQAKTIDRMIADLLQVGRGGDTELP
IIPQKMELGKLCLDVLEELRDRYTSKSQKIETDIPQDLPCVYADPERIRQVLVNLLDNAI
KYTPAGGKISVAGLHRTTQKVQFSIGDTGPGIPDENRDRIFENHFRLQRDEATEGYGIGL
CLCQRIVRSHYGQIWVDSVPNGGAWFHFTLPVYPS
Download sequence
Identical sequences K9PJG0
WP_015129099.1.42896 gi|427718128|ref|YP_007066122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]