SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427718991|ref|YP_007066985.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718991|ref|YP_007066985.1|
Domain Number 1 Region: 47-329
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.44e-33
Family TK-like PP module 0.0093
Further Details:      
 
Domain Number 2 Region: 374-580
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.36e-33
Family TK-like Pyr module 0.02
Further Details:      
 
Domain Number 3 Region: 586-735
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000137
Family Transketolase C-terminal domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427718991|ref|YP_007066985.1|
Sequence length 737
Comment transketolase [Calothrix sp. PCC 7507]
Sequence
MTAITPKASSALPNFCEGIQYFGEALPGFETYGATPTIASGKIAIADPTDPAAVYQTLLA
ADALRYLTLQITGSKASGHPGGFASQAEAYAALVMLGYKNIITEVGHHAPGFYSAMFLDR
SLEDMGIFTVQQLRDRFREKHGLLGHLSGYIPGILAPAGPLGQGQHFAMSAALLHRDKLF
PFTVGDGGLGEPYIVSAIAHFHTAYPSVTNFLPVLVWNGYSQEHHSMVSLKTNAQMIAYW
QGNGFDEVVLVDAKEFDDQNQPGDYVDSTAFSFEKRLEFTKAVLVAVDKAAKSAASGKLT
VFIIKQLKGAGVHATGAKSHNLYPKDTLDAPHIISALQTRALSAEAWQTVRTNAERASGG
PAAKTVVTEFELPLPDLGELPLEEYAVGGDPKVATTAMGRLVGIVGKKDPNFLVTNADGN
EASGIANINQALKIIHPTTDDLYNQAPNGQVYEPLSEDACAGLAAGLALMGARTLWCSYE
SFAINGLPIWQTVTQAMAELRRQTPSTITLFTAGALEQGRNGWTHQRPEIEAYFASLMRN
GNIFPLFPPDANSIQACYDWALKTKNKGIVITASKSPLPIRTTLEQTRQGLRDGAVLLHE
VTGAKQVVFAVIGDLTLIPVFEAAAFLETEGIGVKIVSIINPRRLYRPDDTAWETCSEPD
GGFLEDDKFAELFAGDALIGVTGGAAAMLEPILLRSSSKRDTFAWKRGETTASAGELMAF
NGLTAETLTKRAIALVH
Download sequence
Identical sequences K9PMH0
gi|427718991|ref|YP_007066985.1| WP_015129958.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]