SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427719638|ref|YP_007067632.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427719638|ref|YP_007067632.1|
Domain Number 1 Region: 12-305
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.88e-58
Family Protein kinases, catalytic subunit 0.0000951
Further Details:      
 
Domain Number 2 Region: 415-527
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.88e-29
Family Pentapeptide repeats 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427719638|ref|YP_007067632.1|
Sequence length 539
Comment serine/threonine protein kinase with pentapeptide repeats [Calothrix sp. PCC 7507]
Sequence
MSYCLNPTCPNPENLAHSQKCQSCGSQLLLNDRYQVIKPLGQGGFGATFLACDQALPGEP
SCVIKQLRPSTTAPQVLQMARELFEREAKTLGRIGNHPQIPRLLDYFEDGHHFYLIQEYI
SGATLQQEIKRNGNLSEAGVKQFLSEILPLLQYIHERKVIHRDIKPANLIRRTQDARMVL
IDFGAVKNQVTQAITNQSEHTALTAYAIGTPGFAPPEQMAMRPVYASDIYALGVTCIYLL
TGKSPKDLAYSPTTGEMMWEQLVQVSDHLKSVLRKMLEVSVRNRYQSADDVLRGLEMEPY
LESLAQGLLIKSDLAVKEQAHYHRDDSGILCNNPSASFTSSGVAQVAAAIRARRAKAAEG
AGLHTARMQPGSLTAKQATLGSSNSNGSQSQNSQVARKLDTQSLLTSYLKGRRDFALHNL
SMLNLQGADLSETNFHSAQLRKTNFQGANLRNSDFGKANLAYANLRDANFSKAYLNNADL
EGADLRGADFSYAYLSNANLRGANLCGANLTGAKISEEQLALAKTNWLTVRPNGKRGLL
Download sequence
Identical sequences K9PNV5
WP_015130596.1.42896 gi|427719638|ref|YP_007067632.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]