SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427719978|ref|YP_007067972.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427719978|ref|YP_007067972.1|
Domain Number 1 Region: 95-224
Classification Level Classification E-value
Superfamily CheY-like 1.57e-42
Family CheY-related 0.00037
Further Details:      
 
Domain Number 2 Region: 228-404
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.91e-34
Family Ppx associated domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427719978|ref|YP_007067972.1|
Sequence length 412
Comment response regulator receiver modulated metal dependent phosphohydrolase [Calothrix sp. PCC 7507]
Sequence
MIKWKPKHTGSTAQIVDGSNPPSKVKNMGSNHALGLQNVEGESLGFSKEEIMPENPSALP
SWMKAQNVNFDEDSLASRTLQTKGSKVNGFDSDVPKVLVVDDHAASRMTAVALLSMEGCE
VIEAESGSVAVELVAQKQPDLILLDVMMPGMDGFEVCQILKQNELTRLIPVIFITALNDR
RSRIRGIEVGADDFLTKPFDRVELAARVKSLVRQKRLNEDLDHAEQVLFSVARAIESRDP
NTGDHCERLVKLGEDFGQYLNLSRYQIRDLMWGGYLHDIGKVGIPDAVLLKKGQLTPEDW
QIMKQHVLIGENICQPLRTMRGVIPIIRHHHERWDGSGYPDGLKGDDIPYLAQVFQIIDI
YDALTSERPYKRAFSTEEALQVIMEETNSGWRNPQLIQQFVEFIYSRQNQHE
Download sequence
Identical sequences K9PPT9
gi|427719978|ref|YP_007067972.1| WP_015130935.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]